PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0134s0420.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 610aa    MW: 68550.4 Da    PI: 4.6829
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0134s0420.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.17e-53171432128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                             ppGfrFhPtdeelvv+yLk+k+ +k+l+l ++++evd+yk++P++Lp +  +k+++++w+fFs+rd+ky++g r+nrat++gyWkat
  SapurV1A.0134s0420.1.p  17 PPGFRFHPTDEELVVYYLKRKICKKRLKL-NIVREVDVYKWDPEELPgQsILKTGDRQWFFFSPRDRKYPNGARSNRATRQGYWKAT 102
                             8****************************.89**************96446788999****************************** PP

                     NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             gkd+ v++ ++++vglkktLvfy+grap+g +tdWvmhey++
  SapurV1A.0134s0420.1.p 103 GKDRIVVC-NSRNVGLKKTLVFYRGRAPNGDRTDWVMHEYTM 143
                             ********.999****************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-609166IPR003441NAC domain
PROSITE profilePS5100555.46216166IPR003441NAC domain
PfamPF023656.0E-2817142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MKVTTDSFLG ADDMAWPPGF RFHPTDEELV VYYLKRKICK KRLKLNIVRE VDVYKWDPEE  60
LPGQSILKTG DRQWFFFSPR DRKYPNGARS NRATRQGYWK ATGKDRIVVC NSRNVGLKKT  120
LVFYRGRAPN GDRTDWVMHE YTMDEEELKR CPNVQDYYAL YKVYKKSGAG PKNGEQYGAP  180
FKEEDWVDDE FPRVNGLVTP EIPVKQHIEA TLVDNFKLSA PLELPLNDFE EIIKQIGGEH  240
AFNGLQNNDF SCLQPQVNGE EEAQSTLVDP CFREFVCEPV GELTTSDQHC NKHTNFNFDK  300
SDTSTLRLHE APEVTSATNY EQAPQLNEGD FLEINDLIDP EPYLSNAEQP VENLQFDDFD  360
GLSEFEQYHD AAMFLRDLGP VDQEAVSHSF MHPYGCDMVN QVGYQSQPDS IINAVDYQLQ  420
QSNLVASQVD CDLQPQFFDA EQMNNHLWVH GQRSNMSAAS ESHNGIFFQS PPGDVCESSN  480
NSTIANENQG VKEGDAANGW LSSALWDFVE SIPTTPASAS ENPLVNKAFE RMSSFSRIRM  540
NVKSINVEAA SRIRMNVSSI NVAAANGAAS VRSAGRTKGF VLLSIVVVLC AILWVFLGSG  600
RLSGRSISS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-491314312140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13443KRKICKKRLK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00179DAPTransfer from AT1G34190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002302150.10.0no apical meristem family protein
TrEMBLB9GT490.0B9GT49_POPTR; No apical meristem family protein
STRINGPOPTR_0002s06210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.11e-144NAC domain containing protein 17